Tobacco Etch Virus Protease (TEVp)
Tobacco Etch Virus Protease (TEVp) is a highly sequence‑specific cysteine protease renowned for its precise cleavage of the ENLYFQ|G recognition motif. This exceptional specificity makes TEV protease the go‑to solution for removing fusion partners or affinity tags without compromising your protein of interest, delivering clean, functional proteins ready for any downstream application.
Worldwide distribution of TEV protease
Basic Pharma supplies TEV-protease to universities, laboratories and biotech companies worldwide.
Why choose our TEVp?
Optimized sequence resulting in:
-
Increased solubility
-
Prevention of autocleavage
-
Animal-free and free from viral contamination
-
95% purity verified by SDS-PAGE and HPLC
-
Lyophilized powder for long-term stability and storage
-
Ready-to-use: reconstitution requires no dialysis
-
Batch-to-batch consistency
Specifications
| Product name | Recombinant Histone H3 |
| Source | Bacteria – Escherichia coli |
| Appearance | Off-white Lyophilized from buffer (50 mM Tris; 300 mM NaCl; pH 7,2) |
| Packaging sizes | Sizes upon request |
| Purity | > 95% pure based on SDS PAGE and HPLC |
| Safety | No risk of animal derived contaminations (e.g. viral particles/pathogens) |
| Storage conditions and Stability | Lyophilized (at least 6 months at -20 °C) Reconstituted (typical 1 week @ 4 °C) |
| Disclaimer: This product is for R&D and manufacturing purposes only. Not for direct therapeutic use. | |
| Number of Amino Acids | AA 237 (245 total, incl. Tag etc) |
| Tag | N-term - 7x Histidine Tag |
| Molecular weight | 27,968 Da |
| Extinction Coefficient | 31970 M-1 cm-1 at 280 nm |
| Sequence | MHHHHHHHGESLFKGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE |
| Reference | doi.org/10.1007/s00253-022-11786-5 |
Interested in our recombinant Histone H3?
We are happy to discuss how this product can support your research or manufacturing needs.
Please contact us via biotech@basicpharma.nl or +31 (0)88 255 40 10 or fill in the form below: